General Information

  • ID:  hor006098
  • Uniprot ID:  O97937
  • Protein name:  Insulin-like 3 B chain
  • Gene name:  INSL3
  • Organism:  Callithrix jacchus (White-tufted-ear marmoset)
  • Family:  Insulin family
  • Source:  Animal
  • Expression:  Highest expression in the Leydig cells of the testis.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Callithrix (subgenus), Callithrix (genus), Callitrichinae (subfamily), Cebidae (family), Platyrrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0002020 protease binding; GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0010634 positive regulation of epithelial cell migration; GO:0090303 positive regulation of wound healing
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  PTPEMREKLCGHHFVRALVRVCGGPLWSTEA
  • Length:  31(25-55)
  • Propeptide:  MDPRLPAWALVLLGPALVFALGPAPTPEMREKLCGHHFVRALVRVCGGPLWSTEARRPVAAGDGELLQWLERRHLLYGLVANSEPAPGGPGLQPMPQTSHHHRHRRAAASNPARYCCLSGCSQQDLLTLCP
  • Signal peptide:  MDPRLPAWALVLLGPALVFALGPA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Seems to play a role in testicular function. May be a trophic hormone with a role in testicular descent in fetal life. Is a ligand for LGR8 receptor (By similarity).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  RXFP2, RXFP1
  • Target Unid:   F7HNC5, F7IQL6
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O97937-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006098_AF2.pdbhor006098_ESM.pdb

Physical Information

Mass: 401335 Formula: C153H242N46O41S3
Absent amino acids: DINQY Common amino acids: EGLPRV
pI: 8.25 Basic residues: 6
Polar residues: 8 Hydrophobic residues: 10
Hydrophobicity: -19.68 Boman Index: -4506
Half-Life / Aliphatic Index: >20 hour Aliphatic Index: 72.26
Instability Index: 2460 Extinction Coefficient cystines: 5625
Absorbance 280nm: 187.5

Literature

  • PubMed ID:  9916013
  • Title:  Differential splicing and expression of the relaxin-like factor gene in reproductive tissues of the marmoset monkey (Callithrix jacchus).